HORDB

ID: hor002410
Uniprot ID: P01307
Protein name: Promotilin
Gene name: MLN
Organism: Sus scrofa (Pig)
Family: Motilin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031788 motilin receptor binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: FVPIFTYGELQRMQEKERNKGQKKSLSVQQASEELGPLDPSEPTKEEERVVIKLLAPVDIGIRMDSRQLEKYRATLERLLGQAPQSTQNQNAAK
Length: 94
Propeptide: MVSRKAVVVLLVVHAAAMLASHTEAFVPIFTYGELQRMQEKERNKGQKKSLSVQQASEELGPLDPSEPTKEEERVVIKLLAPVDIGIRMDSRQLEKYRATLERLLGQAPQSTQNQNAAK
Signal peptide: MVSRKAVVVLLVVHAAAMLASHTEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: MLNR
Target Unid: I3LHJ5
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002410_AF2.pdb

hor002410_ESM.pdb

Mass:	1236918	Formula:	C466H770N136O148S2
Absent amino acids:	CHW	Common amino acids:	ELQ
pI:	9.01	Basic residues:	15
Polar residues:	20	Hydrophobic residues:	27
Hydrophobicity:	-87.02	Boman Index:	-24089
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	79.89
Instability Index:	4983.51	Extinction Coefficient cystines:	2980
Absorbance 280nm:	32.04